Lineage for d1hezb2 (1hez B:122-224)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53913Species Fab of human IgM RF 2A2 [49101] (2 PDB entries)
  8. 53921Domain d1hezb2: 1hez B:122-224 [60986]
    Other proteins in same PDB: d1heza1, d1hezb1, d1hezc1, d1hezd1, d1heze_

Details for d1hezb2

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: antibody-antigen complex

SCOP Domain Sequences for d1hezb2:

Sequence, based on SEQRES records: (download)

>d1hezb2 b.1.1.2 (B:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp

Sequence, based on observed residues (ATOM records): (download)

>d1hezb2 b.1.1.2 (B:122-224) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
qvllpshvvckvqhpngnkekdvplp

SCOP Domain Coordinates for d1hezb2:

Click to download the PDB-style file with coordinates for d1hezb2.
(The format of our PDB-style files is described here.)

Timeline for d1hezb2: