Lineage for d1heub1 (1heu B:1-174,B:325-374)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165846Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 165847Protein Alcohol dehydrogenase [50137] (4 species)
  7. 165851Species Horse (Equus caballus) [TaxId:9796] [50138] (26 PDB entries)
  8. 165855Domain d1heub1: 1heu B:1-174,B:325-374 [60981]
    Other proteins in same PDB: d1heua2, d1heub2

Details for d1heub1

PDB Entry: 1heu (more details), 1.15 Å

PDB Description: atomic x-ray structure of liver alcohol dehydrogenase containing cadmium and a hydroxide adduct to nadh

SCOP Domain Sequences for d1heub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heub1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Horse (Equus caballus)}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaasplekvcligcXkdsvp
klvadfmakkfaldplithvlpfekinegfdllrsgesirtiltf

SCOP Domain Coordinates for d1heub1:

Click to download the PDB-style file with coordinates for d1heub1.
(The format of our PDB-style files is described here.)

Timeline for d1heub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1heub2