Class b: All beta proteins [48724] (149 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) |
Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins) |
Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species) belongs to subfamily IIb |
Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries) |
Domain d1hejc_: 1hej C: [60973] XBD2 |
PDB Entry: 1hej (more details)
SCOP Domain Sequences for d1hejc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hejc_ b.2.2.1 (C:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi} tgscsvsavrgeewadrfnvtysvsgssswvvtlglnggqsvqsswnaaltgssgtvtar pngsgnsfgvtfykngssatpgatcatg
Timeline for d1hejc_: