Lineage for d1hejc_ (1hej C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552586Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families) (S)
  5. 552587Family b.2.2.1: Cellulose-binding domain family II [49385] (2 proteins)
  6. 552588Protein Endo-1,4-beta xylanase D, xylan binding domain, XBD [49388] (1 species)
    belongs to subfamily IIb
  7. 552589Species Cellulomonas fimi [TaxId:1708] [49389] (6 PDB entries)
  8. 552591Domain d1hejc_: 1hej C: [60973]
    XBD2

Details for d1hejc_

PDB Entry: 1hej (more details)

PDB Description: c-terminal xylan binding domain from cellulomonas fimi xylanase 11a

SCOP Domain Sequences for d1hejc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hejc_ b.2.2.1 (C:) Endo-1,4-beta xylanase D, xylan binding domain, XBD {Cellulomonas fimi}
tgscsvsavrgeewadrfnvtysvsgssswvvtlglnggqsvqsswnaaltgssgtvtar
pngsgnsfgvtfykngssatpgatcatg

SCOP Domain Coordinates for d1hejc_:

Click to download the PDB-style file with coordinates for d1hejc_.
(The format of our PDB-style files is described here.)

Timeline for d1hejc_: