SCOPe 2.05: Domain d1he9a_: 1he9 A:

Lineage for d1he9a_ (1he9 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.11: Bacterial GAP domain [47233] (1 family)
   contains extra helices in the loops at one end of the bundle

5. Family a.24.11.1: Bacterial GAP domain [47234] (4 proteins)

6. Protein ExoS toxin [47235] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [47236] (2 PDB entries)

8. Domain d1he9a_: 1he9 A: [60971]

Details for d1he9a_

PDB Entry: 1he9, 2.4 Å

PDB Description: crystal structure of the gap domain of the pseudomonas aeruginosa exos toxin

PDB Compounds: (A:) exoenzyme s

SCOPe Domain Sequences for d1he9a_:

Sequence; same for both SEQRES and ATOM records:

>d1he9a_ a.24.11.1 (A:) ExoS toxin {Pseudomonas aeruginosa [TaxId: 287]}
kqmvlqqalpmtlkgldkaselatltpeglarehsrlasgdgalrslstalagiragsqv
eesriqagrllersiggialqqwgttggaasqlvldaspelrreitdqlhqvmsevallr
qavesevsrvsady

Timeline for d1he9a_:

• d1he9a_ first appeared in SCOP 1.57
  
• d1he9a_ appears in SCOPe 2.04
  
• d1he9a_ is called d1he9a1 in SCOPe 2.06
  
• d1he9a_ appears in the current release, SCOPe 2.08, called d1he9a1