SCOPe 2.06: Domain d1he7a1: 1he7 A:285-389

Lineage for d1he7a1 (1he7 A:285-389)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries)

8. Domain d1he7a1: 1he7 A:285-389 [60970]
   Other proteins in same PDB: d1he7a2
   swapped N-terminal strand dimer; only one subunit is in the PDB entry
   complexed with gol

Details for d1he7a1

PDB Entry: 1he7, 2 Å

PDB Description: human nerve growth factor receptor trka

PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d1he7a1:

Sequence; same for both SEQRES and ATOM records:

>d1he7a1 b.1.1.4 (A:285-389) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
pasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetvrhg
clrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnped

Timeline for d1he7a1:

• d1he7a1 first appeared in SCOP 1.57, called d1he7a_
  
• d1he7a1 was called d1he7a_ in SCOPe 2.05
  
• d1he7a1 appears in SCOPe 2.07
  
• d1he7a1 appears in the current release, SCOPe 2.08