Lineage for d1he7a_ (1he7 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 935313Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 935449Protein High affinity nerve growth factor receptor TrkA, different domains [49190] (1 species)
  7. 935450Species Human (Homo sapiens) [TaxId:9606] [49191] (4 PDB entries)
  8. 935451Domain d1he7a_: 1he7 A: [60970]
    swapped N-terminal strand dimer; only one subunit is in the PDB entry
    complexed with gol

Details for d1he7a_

PDB Entry: 1he7 (more details), 2 Å

PDB Description: human nerve growth factor receptor trka
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d1he7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]}
shmpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefnpe

SCOPe Domain Coordinates for d1he7a_:

Click to download the PDB-style file with coordinates for d1he7a_.
(The format of our PDB-style files is described here.)

Timeline for d1he7a_: