Class b: All beta proteins [48724] (165 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) |
Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein) |
Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species) the N-terminal domain is cytochrome c-like |
Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries) formerly Thiosphaera pantotropha |
Domain d1hcma2: 1hcm A:134-567 [60959] Other proteins in same PDB: d1hcma1, d1hcmb1 |
PDB Entry: 1hcm (more details), 2.5 Å
SCOP Domain Sequences for d1hcma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcma2 b.70.2.1 (A:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} ppefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvl dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi vnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtke gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp tgkfnvyntmtdty
Timeline for d1hcma2: