Lineage for d1hcib3 (1hci B:512-632)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985819Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 1985820Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 1985821Protein alpha-actinin [46971] (1 species)
  7. 1985822Species Human (Homo sapiens) [TaxId:9606] [46972] (2 PDB entries)
  8. 1985831Domain d1hcib3: 1hci B:512-632 [60956]
    the rod domain: homodimer of four-repeat fragments

Details for d1hcib3

PDB Entry: 1hci (more details), 2.8 Å

PDB Description: crystal structure of the rod domain of alpha-actinin
PDB Compounds: (B:) alpha-actinin 2

SCOPe Domain Sequences for d1hcib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcib3 a.7.1.1 (B:512-632) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}
etidqlhlefakraapfnnwmegamedlqdmfivhsieeiqslitaheqfkatlpeadge
rqsimaiqnevekviqsynirisssnpystvtmdelrtkwdkvkqlvpirdqslqeelar
q

SCOPe Domain Coordinates for d1hcib3:

Click to download the PDB-style file with coordinates for d1hcib3.
(The format of our PDB-style files is described here.)

Timeline for d1hcib3: