Lineage for d1hcib2 (1hci B:397-511)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2308818Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2308819Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
  6. 2308820Protein alpha-actinin [46971] (1 species)
  7. 2308821Species Human (Homo sapiens) [TaxId:9606] [46972] (2 PDB entries)
  8. 2308829Domain d1hcib2: 1hci B:397-511 [60955]
    the rod domain: homodimer of four-repeat fragments

Details for d1hcib2

PDB Entry: 1hci (more details), 2.8 Å

PDB Description: crystal structure of the rod domain of alpha-actinin
PDB Compounds: (B:) alpha-actinin 2

SCOPe Domain Sequences for d1hcib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcib2 a.7.1.1 (B:397-511) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}
erlehlaekfrqkasthetwaygkeqillqkdyesasltevrallrkheafesdlaahqd
rveqiaaiaqelneldyhdavnvndrcqkicdqwdrlgtltqkrrealermekll

SCOPe Domain Coordinates for d1hcib2:

Click to download the PDB-style file with coordinates for d1hcib2.
(The format of our PDB-style files is described here.)

Timeline for d1hcib2: