![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.1: Spectrin repeat [46966] (2 families) ![]() |
![]() | Family a.7.1.1: Spectrin repeat [46967] (3 proteins) this is a repeat family; one repeat unit is 1hci A:512-632 found in domain |
![]() | Protein alpha-actinin [46971] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46972] (3 PDB entries) |
![]() | Domain d1hcia2: 1hci A:397-511 [60951] Other proteins in same PDB: d1hcia5, d1hcib5 the rod domain: homodimer of four-repeat fragments |
PDB Entry: 1hci (more details), 2.8 Å
SCOPe Domain Sequences for d1hcia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcia2 a.7.1.1 (A:397-511) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} erlehlaekfrqkasthetwaygkeqillqkdyesasltevrallrkheafesdlaahqd rveqiaaiaqelneldyhdavnvndrcqkicdqwdrlgtltqkrrealermekll
Timeline for d1hcia2: