Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) |
Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) |
Domain d1hc7d1: 1hc7 D:277-403 [60947] Other proteins in same PDB: d1hc7a2, d1hc7a3, d1hc7b2, d1hc7b3, d1hc7c2, d1hc7c3, d1hc7d2, d1hc7d3 complexed with zn |
PDB Entry: 1hc7 (more details), 2.43 Å
SCOPe Domain Sequences for d1hc7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc7d1 c.51.1.1 (D:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]} rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra lafredh
Timeline for d1hc7d1: