Lineage for d1hc7b3 (1hc7 B:404-477)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726646Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 726647Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 726648Protein C-terminal domain of ProRS [64588] (3 species)
  7. 726659Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 726661Domain d1hc7b3: 1hc7 B:404-477 [60943]
    Other proteins in same PDB: d1hc7a1, d1hc7a2, d1hc7b1, d1hc7b2, d1hc7c1, d1hc7c2, d1hc7d1, d1hc7d2

Details for d1hc7b3

PDB Entry: 1hc7 (more details), 2.43 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus
PDB Compounds: (B:) prolyl-tRNA synthetase

SCOP Domain Sequences for d1hc7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hc7b3 d.68.5.1 (B:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOP Domain Coordinates for d1hc7b3:

Click to download the PDB-style file with coordinates for d1hc7b3.
(The format of our PDB-style files is described here.)

Timeline for d1hc7b3: