Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) contains a metal (zinc)-binding site |
Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein) |
Protein C-terminal domain of ProRS [64588] (3 species) |
Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries) |
Domain d1hc7a3: 1hc7 A:404-477 [60940] Other proteins in same PDB: d1hc7a1, d1hc7a2, d1hc7b1, d1hc7b2, d1hc7c1, d1hc7c2, d1hc7d1, d1hc7d2 |
PDB Entry: 1hc7 (more details), 2.43 Å
SCOP Domain Sequences for d1hc7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc7a3 d.68.5.1 (A:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]} trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr psaygkrvvfakay
Timeline for d1hc7a3: