Lineage for d1hbxg_ (1hbx G:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259172Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1259206Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 1259207Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)
  8. 1259211Domain d1hbxg_: 1hbx G: [60934]
    Other proteins in same PDB: d1hbxa_, d1hbxb_, d1hbxd_, d1hbxe_
    protein/DNA complex

Details for d1hbxg_

PDB Entry: 1hbx (more details), 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna
PDB Compounds: (G:) ets-domain protein elk-4

SCOPe Domain Sequences for d1hbxg_:

Sequence, based on SEQRES records: (download)

>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
dsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsr
alryyyvkniikkvngqkfvykfvsypeilnmdpmtvgriegdceslnfsevsssskdve
nggkdkppqpgaktssrndyihsglyssftlnsln

Sequence, based on observed residues (ATOM records): (download)

>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
dsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydklsr
alryyyvkniikkvngqkfvykfvsypeilnmsrndyihsglyssftlnsln

SCOPe Domain Coordinates for d1hbxg_:

Click to download the PDB-style file with coordinates for d1hbxg_.
(The format of our PDB-style files is described here.)

Timeline for d1hbxg_: