SCOP 1.57: Domain d1hbxb_: 1hbx B:

Lineage for d1hbxb_ (1hbx B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (3 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (2 PDB entries)

8. Domain d1hbxb_: 1hbx B: [60931]
   Other proteins in same PDB: d1hbxg_, d1hbxh_

Details for d1hbxb_

PDB Entry: 1hbx, 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

SCOP Domain Sequences for d1hbxb_:

Sequence; same for both SEQRES and ATOM records:

>d1hbxb_ d.88.1.1 (B:) Serum response factor (SRF) core {Human (Homo sapiens)}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclnspd

Timeline for d1hbxb_:

• d1hbxb_ is new in SCOP 1.57
  
• d1hbxb_ appears in SCOP 1.59
  
• d1hbxb_ appears in the current release, SCOPe 2.08