Lineage for d1hbxa_ (1hbx A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415295Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 415296Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 415297Family d.88.1.1: SRF-like [55456] (4 proteins)
  6. 415314Protein Serum response factor (SRF) core [55457] (1 species)
  7. 415315Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)
  8. 415320Domain d1hbxa_: 1hbx A: [60930]
    Other proteins in same PDB: d1hbxg_, d1hbxh_

Details for d1hbxa_

PDB Entry: 1hbx (more details), 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

SCOP Domain Sequences for d1hbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbxa_ d.88.1.1 (A:) Serum response factor (SRF) core {Human (Homo sapiens)}
gkktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvyt
fatrklqpmitsetgkaliqtclnspd

SCOP Domain Coordinates for d1hbxa_:

Click to download the PDB-style file with coordinates for d1hbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1hbxa_: