![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
![]() | Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
![]() | Family d.88.1.1: SRF-like [55456] (4 proteins) |
![]() | Protein Serum response factor (SRF) core [55457] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries) |
![]() | Domain d1hbxa_: 1hbx A: [60930] Other proteins in same PDB: d1hbxg_, d1hbxh_ |
PDB Entry: 1hbx (more details), 3.15 Å
SCOP Domain Sequences for d1hbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbxa_ d.88.1.1 (A:) Serum response factor (SRF) core {Human (Homo sapiens)} gkktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvyt fatrklqpmitsetgkaliqtclnspd
Timeline for d1hbxa_: