Lineage for d1hbue2 (1hbu E:2-188)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329801Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 329821Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 329840Protein Beta chain [55099] (3 species)
  7. 329841Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)
  8. 329851Domain d1hbue2: 1hbu E:2-188 [60926]
    Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbuc_, d1hbud1, d1hbud2, d1hbue1, d1hbuf_
    complexed with cl, com, f43, gol, mg, mgn, na, tp7, zn

Details for d1hbue2

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

SCOP Domain Sequences for d1hbue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbue2 d.58.31.2 (E:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOP Domain Coordinates for d1hbue2:

Click to download the PDB-style file with coordinates for d1hbue2.
(The format of our PDB-style files is described here.)

Timeline for d1hbue2: