SCOP 1.57: Domain d1hbue2: 1hbu E:2-188

Lineage for d1hbue2 (1hbu E:2-188)

Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
Protein Beta chain [55099] (3 species)
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)
Domain d1hbue2: 1hbu E:2-188 [60926]
Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbuc_, d1hbud1, d1hbud2, d1hbue1, d1hbuf_

Details for d1hbue2

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

SCOP Domain Sequences for d1hbue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbue2 d.58.31.2 (E:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOP Domain Coordinates for d1hbue2:

Click to download the PDB-style file with coordinates for d1hbue2.
(The format of our PDB-style files is described here.)

Timeline for d1hbue2: