Lineage for d1hbud2 (1hbu D:2-269)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417867Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1417901Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1417902Protein Alpha chain [55095] (3 species)
  7. 1417903Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 1417923Domain d1hbud2: 1hbu D:2-269 [60924]
    Other proteins in same PDB: d1hbua1, d1hbub1, d1hbub2, d1hbuc_, d1hbud1, d1hbue1, d1hbue2, d1hbuf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbud2

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbud2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1hbud2:

Click to download the PDB-style file with coordinates for d1hbud2.
(The format of our PDB-style files is described here.)

Timeline for d1hbud2: