| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
| Protein Alpha chain [55095] (3 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries) |
| Domain d1hbud2: 1hbu D:2-269 [60924] Other proteins in same PDB: d1hbua1, d1hbub1, d1hbub2, d1hbuc_, d1hbud1, d1hbue1, d1hbue2, d1hbuf_ complexed with cl, com, f43, gol, mg, mgn, na, tp7, zn |
PDB Entry: 1hbu (more details), 1.9 Å
SCOP Domain Sequences for d1hbud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbud2 d.58.31.2 (D:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv
Timeline for d1hbud2: