| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein) |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries) |
| Domain d1hbuc_: 1hbu C: [60922] Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub1, d1hbub2, d1hbud1, d1hbud2, d1hbue1, d1hbue2 |
PDB Entry: 1hbu (more details), 1.9 Å
SCOP Domain Sequences for d1hbuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbuc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl
Timeline for d1hbuc_: