Lineage for d1hbub1 (1hbu B:189-443)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644818Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 644819Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (1 family) (S)
  5. 644820Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 644839Protein Beta chain [48087] (3 species)
  7. 644840Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (5 PDB entries)
  8. 644847Domain d1hbub1: 1hbu B:189-443 [60920]
    Other proteins in same PDB: d1hbua1, d1hbua2, d1hbub2, d1hbuc_, d1hbud1, d1hbud2, d1hbue2, d1hbuf_

Details for d1hbub1

PDB Entry: 1hbu (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m
PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOP Domain Sequences for d1hbub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbub1 a.89.1.1 (B:189-443) Beta chain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOP Domain Coordinates for d1hbub1:

Click to download the PDB-style file with coordinates for d1hbub1.
(The format of our PDB-style files is described here.)

Timeline for d1hbub1: