SCOPe 2.06: Domain d1hbua1: 1hbu A:270-549

Lineage for d1hbua1 (1hbu A:270-549)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [48083] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)

8. Domain d1hbua1: 1hbu A:270-549 [60918]
   Other proteins in same PDB: d1hbua2, d1hbub1, d1hbub2, d1hbuc_, d1hbud2, d1hbue1, d1hbue2, d1hbuf_
   complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbua1

PDB Entry: 1hbu, 1.9 Å

PDB Description: methyl-coenzyme m reductase in the mcr-red1-silent state in complex with coenzyme m

PDB Compounds: (A:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbua1:

Sequence; same for both SEQRES and ATOM records:

>d1hbua1 a.89.1.1 (A:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

Timeline for d1hbua1:

• d1hbua1 first appeared in SCOP 1.57
  
• d1hbua1 appears in SCOPe 2.05
  
• d1hbua1 appears in SCOPe 2.07
  
• d1hbua1 appears in the current release, SCOPe 2.08