Lineage for d1hbof_ (1hbo F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 134153Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 134154Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 134155Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 134156Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 134164Domain d1hbof_: 1hbo F: [60917]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob1, d1hbob2, d1hbod1, d1hbod2, d1hboe1, d1hboe2

Details for d1hbof_

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

SCOP Domain Sequences for d1hbof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbof_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbof_:

Click to download the PDB-style file with coordinates for d1hbof_.
(The format of our PDB-style files is described here.)

Timeline for d1hbof_: