SCOP 1.61: Domain d1hbod2: 1hbo D:2-269

Lineage for d1hbod2 (1hbo D:2-269)

Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
Protein Alpha chain [55095] (3 species)
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
Domain d1hbod2: 1hbo D:2-269 [60914]
Other proteins in same PDB: d1hboa1, d1hbob1, d1hbob2, d1hboc_, d1hbod1, d1hboe1, d1hboe2, d1hbof_

Details for d1hbod2

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

SCOP Domain Sequences for d1hbod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbod2 d.58.31.2 (D:2-269) Alpha chain {Archaeon Methanobacterium thermoautotrophicum}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOP Domain Coordinates for d1hbod2:

Click to download the PDB-style file with coordinates for d1hbod2.
(The format of our PDB-style files is described here.)

Timeline for d1hbod2: