Lineage for d1hboc_ (1hbo C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417867Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1417868Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
    automatically mapped to Pfam PF02240
  6. 1417869Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 1417870Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries)
  8. 1417889Domain d1hboc_: 1hbo C: [60912]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob1, d1hbob2, d1hbod1, d1hbod2, d1hboe1, d1hboe2
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hboc_

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent
PDB Compounds: (C:) methyl-coenzyme m reductase I gamma subunit

SCOPe Domain Sequences for d1hboc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hboc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOPe Domain Coordinates for d1hboc_:

Click to download the PDB-style file with coordinates for d1hboc_.
(The format of our PDB-style files is described here.)

Timeline for d1hboc_: