Lineage for d1hboc_ (1hbo C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192859Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
  5. 192860Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 192861Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 192862Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 192869Domain d1hboc_: 1hbo C: [60912]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob1, d1hbob2, d1hbod1, d1hbod2, d1hboe1, d1hboe2

Details for d1hboc_

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

SCOP Domain Sequences for d1hboc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hboc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hboc_:

Click to download the PDB-style file with coordinates for d1hboc_.
(The format of our PDB-style files is described here.)

Timeline for d1hboc_: