SCOP 1.71: Domain d1hbob2: 1hbo B:2-188

Lineage for d1hbob2 (1hbo B:2-188)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
   C-terminal domain is all-alpha

6. Protein Beta chain [55099] (3 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (5 PDB entries)

8. Domain d1hbob2: 1hbo B:2-188 [60911]
   Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob1, d1hboc_, d1hbod1, d1hbod2, d1hboe1, d1hbof_

Details for d1hbob2

PDB Entry: 1hbo, 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

SCOP Domain Sequences for d1hbob2:

Sequence; same for both SEQRES and ATOM records:

>d1hbob2 d.58.31.2 (B:2-188) Beta chain {Archaeon Methanobacterium thermoautotrophicum}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

Timeline for d1hbob2:

• d1hbob2 first appeared in SCOP 1.57
  
• d1hbob2 appears in SCOP 1.69
  
• d1hbob2 appears in SCOP 1.73
  
• d1hbob2 appears in the current release, SCOPe 2.08