Lineage for d1hbnf_ (1hbn F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604877Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 604878Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 604879Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 604880Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 604882Domain d1hbnf_: 1hbn F: [60907]
    Other proteins in same PDB: d1hbna1, d1hbna2, d1hbnb1, d1hbnb2, d1hbnd1, d1hbnd2, d1hbne1, d1hbne2
    complexed with cl, com, f43, gol, mg, mgn, na, tp7, zn

Details for d1hbnf_

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

SCOP Domain Sequences for d1hbnf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbnf_:

Click to download the PDB-style file with coordinates for d1hbnf_.
(The format of our PDB-style files is described here.)

Timeline for d1hbnf_: