Lineage for d1hbmb1 (1hbm B:189-443)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741072Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1741073Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1741074Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1741105Protein Beta chain [48087] (3 species)
  7. 1741106Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 1741121Domain d1hbmb1: 1hbm B:189-443 [60890]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb2, d1hbmc_, d1hbmd1, d1hbmd2, d1hbme2, d1hbmf_
    complexed with cl, f43, gol, mg, na, sht, zn

Details for d1hbmb1

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex
PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hbmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmb1 a.89.1.1 (B:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d1hbmb1:

Click to download the PDB-style file with coordinates for d1hbmb1.
(The format of our PDB-style files is described here.)

Timeline for d1hbmb1: