SCOPe 2.06: Domain d1hayb_: 1hay B:

Lineage for d1hayb_ (1hay B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)

8. Domain d1hayb_: 1hay B: [60884]
   complexed with ca, so4

Details for d1hayb_

PDB Entry: 1hay, 1.7 Å

PDB Description: snapshots of serine protease catalysis: (b) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 10 for 10 seconds

PDB Compounds: (B:) Elastase 1

SCOPe Domain Sequences for d1hayb_:

Sequence; same for both SEQRES and ATOM records:

>d1hayb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lrnnspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1hayb_:

• d1hayb_ first appeared in SCOP 1.57
  
• d1hayb_ appears in SCOPe 2.05
  
• d1hayb_ appears in SCOPe 2.07
  
• d1hayb_ appears in the current release, SCOPe 2.08