SCOP 1.69: Domain d1hawa1: 1haw A:1-159

Lineage for d1hawa1 (1haw A:1-159)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (12 PDB entries)

8. Domain d1hawa1: 1haw A:1-159 [60881]

Details for d1hawa1

PDB Entry: 1haw, 1.9 Å

PDB Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution

SCOP Domain Sequences for d1hawa1:

Sequence; same for both SEQRES and ATOM records:

>d1hawa1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

Timeline for d1hawa1:

• d1hawa1 first appeared in SCOP 1.57
  
• d1hawa1 appears in SCOP 1.67
  
• d1hawa1 appears in SCOP 1.71
  
• d1hawa1 appears in the current release, SCOPe 2.08