Lineage for d1haua2 (1hau A:160-336)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) Protein Nitrite reductase, NIR [49551] (3 species) 
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (6 PDB entries) 
Domain d1haua2: 1hau A:160-336 [60880]
Details for d1haua2
PDB Entry: 1hau (more details), 1.9 Å
PDB Description: x-ray structure of a blue copper nitrite reductase at high ph and in copper free form at 1.9 a resolution
SCOP Domain Sequences for d1haua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1haua2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
SCOP Domain Coordinates for d1haua2:
Click to download the PDB-style file with coordinates for d1haua2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1haua2:
- d1haua2 is new in SCOP 1.57
- d1haua2 appears in SCOP 1.59
- d1haua2 appears in the current release, SCOPe 2.08
View in 3D
