Lineage for d1ha6a_ (1ha6 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (21 proteins) 
Protein Macrophage inflammatory protein, MIP [54128] (4 species) 
Species Mouse (Mus musculus), ccl20/mip-3a [TaxId:10090] [64214] (1 PDB entry) 
Domain d1ha6a_: 1ha6 A: [60875]
Details for d1ha6a_
PDB Entry: 1ha6 (more details)
PDB Description: nmr solution structure of murine ccl20/mip-3a chemokine
SCOP Domain Sequences for d1ha6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha6a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Mouse (Mus musculus), ccl20/mip-3a}
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkrav
nllslrvkkm
SCOP Domain Coordinates for d1ha6a_:
Click to download the PDB-style file with coordinates for d1ha6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ha6a_:
- d1ha6a_ first appeared in SCOP 1.57
- d1ha6a_ appears in SCOP 1.61
- d1ha6a_ appears in the current release, SCOPe 2.08
View in 3D