Lineage for d1ha6a_ (1ha6 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77417Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 77418Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins)
  6. 77470Protein Macrophage inflammatory protein, MIP [54128] (4 species)
  7. 77487Species Mouse (Mus musculus), ccl20/mip-3a [TaxId:10090] [64214] (1 PDB entry)
  8. 77488Domain d1ha6a_: 1ha6 A: [60875]

Details for d1ha6a_

PDB Entry: 1ha6 (more details)

PDB Description: nmr solution structure of murine ccl20/mip-3a chemokine

SCOP Domain Sequences for d1ha6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha6a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Mouse (Mus musculus), ccl20/mip-3a}
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkrav
nllslrvkkm

SCOP Domain Coordinates for d1ha6a_:

Click to download the PDB-style file with coordinates for d1ha6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ha6a_: