![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries) |
![]() | Domain d1ha3b2: 1ha3 B:313-405 [60873] Other proteins in same PDB: d1ha3a1, d1ha3a3, d1ha3b1, d1ha3b3 complexed with bme, gdp, mau, mg |
PDB Entry: 1ha3 (more details), 2 Å
SCOP Domain Sequences for d1ha3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha3b2 b.44.1.1 (B:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d1ha3b2: