Lineage for d1ha2a2 (1ha2 A:197-388)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101110Fold a.126: Serum albumin-like [48551] (1 superfamily)
  4. 101111Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 101112Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 101113Protein Serum albumin [48554] (1 species)
  7. 101114Species Human (Homo sapiens) [TaxId:9606] [48555] (18 PDB entries)
  8. 101119Domain d1ha2a2: 1ha2 A:197-388 [60867]

Details for d1ha2a2

PDB Entry: 1ha2 (more details), 2.5 Å

PDB Description: human serum albumin complexed with myristic acid and the s-(-) enantiomer of warfarin

SCOP Domain Sequences for d1ha2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha2a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens)}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1ha2a2:

Click to download the PDB-style file with coordinates for d1ha2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha2a2: