Lineage for d1ha2a2 (1ha2 A:197-388)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50986Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 50987Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 50988Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 50989Protein Serum albumin [48554] (1 species)
  7. 50990Species Human (Homo sapiens) [TaxId:9606] [48555] (16 PDB entries)
  8. 50992Domain d1ha2a2: 1ha2 A:197-388 [60867]

Details for d1ha2a2

PDB Entry: 1ha2 (more details), 2.5 Å

PDB Description: human serum albumin complexed with myristic acid and the s-(-) enantiomer of warfarin

SCOP Domain Sequences for d1ha2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha2a2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens)}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1ha2a2:

Click to download the PDB-style file with coordinates for d1ha2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha2a2: