SCOP 1.73: Domain d1ha2a1: 1ha2 A:3-196

Lineage for d1ha2a1 (1ha2 A:3-196)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (46 PDB entries)

8. Domain d1ha2a1: 1ha2 A:3-196 [60866]

Details for d1ha2a1

PDB Entry: 1ha2, 2.5 Å

PDB Description: human serum albumin complexed with myristic acid and the s-(-) enantiomer of warfarin

PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d1ha2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ha2a1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d1ha2a1:

• d1ha2a1 first appeared in SCOP 1.57
  
• d1ha2a1 appears in SCOP 1.71
  
• d1ha2a1 appears in SCOP 1.75
  
• d1ha2a1 appears in the current release, SCOPe 2.08