Lineage for d1h9za3 (1h9z A:389-584)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50986Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 50987Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 50988Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 50989Protein Serum albumin [48554] (1 species)
  7. 50990Species Human (Homo sapiens) [TaxId:9606] [48555] (16 PDB entries)
  8. 50996Domain d1h9za3: 1h9z A:389-584 [60865]

Details for d1h9za3

PDB Entry: 1h9z (more details), 2.5 Å

PDB Description: human serum albumin complexed with myristic acid and the r-(+) enantiomer of warfarin

SCOP Domain Sequences for d1h9za3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9za3 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens)}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOP Domain Coordinates for d1h9za3:

Click to download the PDB-style file with coordinates for d1h9za3.
(The format of our PDB-style files is described here.)

Timeline for d1h9za3: