SCOP 1.75: Domain d1h9za2: 1h9z A:197-388

Lineage for d1h9za2 (1h9z A:197-388)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
   Uniprot P02768 29-596

8. Domain d1h9za2: 1h9z A:197-388 [60864]

Details for d1h9za2

PDB Entry: 1h9z, 2.5 Å

PDB Description: human serum albumin complexed with myristic acid and the r-(+) enantiomer of warfarin

PDB Compounds: (A:) serum albumin

SCOP Domain Sequences for d1h9za2:

Sequence; same for both SEQRES and ATOM records:

>d1h9za2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d1h9za2:

• d1h9za2 first appeared in SCOP 1.57
  
• d1h9za2 appears in SCOP 1.73
  
• d1h9za2 appears in SCOPe 2.01
  
• d1h9za2 appears in the current release, SCOPe 2.08