Lineage for d1h9xb2 (1h9x B:134-567)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302133Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 302158Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 302159Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 302160Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 302166Species Paracoccus pantotrophus [TaxId:82367] [51007] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 302184Domain d1h9xb2: 1h9x B:134-567 [60858]
    Other proteins in same PDB: d1h9xa1, d1h9xb1
    complexed with dhe, hec, nhe, so4

Details for d1h9xb2

PDB Entry: 1h9x (more details), 2.1 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

SCOP Domain Sequences for d1h9xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9xb2 b.70.2.1 (B:134-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
ppefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvl
dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
vnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtke
gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
tgkfnvyntmtdty

SCOP Domain Coordinates for d1h9xb2:

Click to download the PDB-style file with coordinates for d1h9xb2.
(The format of our PDB-style files is described here.)

Timeline for d1h9xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9xb1