Lineage for d1h9wb_ (1h9w B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042425Species Duke (Dioclea guianensis) [TaxId:99571] [63729] (2 PDB entries)
    natural circle permutation resulting from a post-translational modification of precursor
  8. 2042427Domain d1h9wb_: 1h9w B: [60854]
    complexed with ca, mn

Details for d1h9wb_

PDB Entry: 1h9w (more details), 2 Å

PDB Description: native dioclea guianensis seed lectin
PDB Compounds: (B:) seed lectin

SCOPe Domain Sequences for d1h9wb_:

Sequence, based on SEQRES records: (download)

>d1h9wb_ b.29.1.1 (B:) Legume lectin {Duke (Dioclea guianensis) [TaxId: 99571]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvh
iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpda

Sequence, based on observed residues (ATOM records): (download)

>d1h9wb_ b.29.1.1 (B:) Legume lectin {Duke (Dioclea guianensis) [TaxId: 99571]}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklkansl
hfsfnqfsqnpkdlilqgdattdsdgnleltkvsssgdpqgssvgralfyapvhiweksa
vvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpda

SCOPe Domain Coordinates for d1h9wb_:

Click to download the PDB-style file with coordinates for d1h9wb_.
(The format of our PDB-style files is described here.)

Timeline for d1h9wb_: