SCOPe 2.06: Domain d1h9va1: 1h9v A:1-88

Lineage for d1h9va1 (1h9v A:1-88)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), IIa [TaxId:9606] [49197] (2 PDB entries)

8. Domain d1h9va1: 1h9v A:1-88 [60851]

Details for d1h9va1

PDB Entry: 1h9v, 3 Å

PDB Description: human fc-gamma-receptor iia (fcgriia), monoclinic

PDB Compounds: (A:) low affinity immunoglobulin gamma fc receptor II-a

SCOPe Domain Sequences for d1h9va1:

Sequence; same for both SEQRES and ATOM records:

>d1h9va1 b.1.1.4 (A:1-88) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIa [TaxId: 9606]}
appkavlkleppwinvlqedsvtltcqgarspesdsiqwfhngnlipthtqpsyrfkann
ndsgeytcqtgqtslsdpvhltvlsewl

Timeline for d1h9va1:

• d1h9va1 first appeared in SCOP 1.57
  
• d1h9va1 appears in SCOPe 2.05
  
• d1h9va1 appears in SCOPe 2.07
  
• d1h9va1 appears in the current release, SCOPe 2.08