SCOPe 2.08: Domain d1h9tb2: 1h9t B:79-230

Lineage for d1h9tb2 (1h9t B:79-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
   core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family)

5. Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 proteins)

6. Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)

7. Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)

8. Domain d1h9tb2: 1h9t B:79-230 [60850]
   Other proteins in same PDB: d1h9ta1, d1h9tb1
   complexed with au, cl

Details for d1h9tb2

PDB Entry: 1h9t, 3.25 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli in complex with fadb operator

PDB Compounds: (B:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1h9tb2:

Sequence; same for both SEQRES and ATOM records:

>d1h9tb2 a.78.1.1 (B:79-230) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqknl

Timeline for d1h9tb2:

• d1h9tb2 first appeared in SCOP 1.57
  
• d1h9tb2 appears in SCOPe 2.07