SCOPe 2.05: Domain d1h9rb1: 1h9r B:123-199

Lineage for d1h9rb1 (1h9r B:123-199)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
   duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands
   automatically mapped to Pfam PF03459

6. Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)

7. Species Escherichia coli [TaxId:562] [50337] (5 PDB entries)

8. Domain d1h9rb1: 1h9r B:123-199 [60841]
   complexed with ni, wo4

Details for d1h9rb1

PDB Entry: 1h9r, 1.9 Å

PDB Description: tungstate bound complex dimop domain of mode from e.coli

PDB Compounds: (B:) molybdenum transport protein mode

SCOPe Domain Sequences for d1h9rb1:

Sequence; same for both SEQRES and ATOM records:

>d1h9rb1 b.40.6.2 (B:123-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]}
mqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlill
kapwvgitqdeavaqna

Timeline for d1h9rb1:

• d1h9rb1 first appeared in SCOP 1.57
  
• d1h9rb1 appears in SCOPe 2.04
  
• d1h9rb1 appears in SCOPe 2.06
  
• d1h9rb1 appears in the current release, SCOPe 2.08