Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins) duplication: tandem repeat of two OB-fold domains with swapped C-terminal strands automatically mapped to Pfam PF03459 |
Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species) |
Species Escherichia coli [TaxId:562] [50337] (5 PDB entries) |
Domain d1h9ra1: 1h9r A:123-199 [60839] complexed with ni, wo4 |
PDB Entry: 1h9r (more details), 1.9 Å
SCOPe Domain Sequences for d1h9ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9ra1 b.40.6.2 (A:123-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} mqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlill kapwvgitqdeavaqna
Timeline for d1h9ra1: