Lineage for d1h9pa_ (1h9p A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371296Species Duke (Dioclea guianensis) [TaxId:99571] [63729] (2 PDB entries)
    natural circle permutation resulting from a post-translational modification of precursor
  8. 371299Domain d1h9pa_: 1h9p A: [60838]
    complexed with cd, mn

Details for d1h9pa_

PDB Entry: 1h9p (more details), 2 Å

PDB Description: crystal structure of dioclea guianensis seed lectin

SCOP Domain Sequences for d1h9pa_:

Sequence, based on SEQRES records: (download)

>d1h9pa_ b.29.1.1 (A:) Legume lectin {Duke (Dioclea guianensis)}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adanslhfsfnqfsqnpkdlilqsdattdsdgnleltkvsssgdpqgssvgralfyapvh
iweksavvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d1h9pa_ b.29.1.1 (A:) Legume lectin {Duke (Dioclea guianensis)}
adtivaveldsypntdigdpsyphigidiksirskstarwnmqtgkvgtahisynsvakr
lsavvsytgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktdan
slhfsfnqfsqnpkdlilqsdattdsdgnleltkvsssgdpqgssvgralfyapvhiwek
savvasfdatftflikspdrdpadgitffiantdtsipsgsggrllglfpdan

SCOP Domain Coordinates for d1h9pa_:

Click to download the PDB-style file with coordinates for d1h9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1h9pa_: