Lineage for d1h9db_ (1h9d B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061544Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 2061545Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 2061546Family b.54.1.1: Core binding factor beta, CBF [50724] (2 protein domains)
  6. 2061547Protein Core binding factor beta, CBF [50725] (2 species)
  7. 2061548Species Human (Homo sapiens) [TaxId:9606] [50726] (3 PDB entries)
  8. 2061549Domain d1h9db_: 1h9d B: [60822]
    Other proteins in same PDB: d1h9da_, d1h9dc_
    protein/DNA complex

Details for d1h9db_

PDB Entry: 1h9d (more details), 2.6 Å

PDB Description: aml1/cbf-beta/dna complex
PDB Compounds: (B:) core-binding factor cbf-beta

SCOPe Domain Sequences for d1h9db_:

Sequence, based on SEQRES records: (download)

>d1h9db_ b.54.1.1 (B:) Core binding factor beta, CBF {Human (Homo sapiens) [TaxId: 9606]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlqrldg
mgclefdeeraqqe

Sequence, based on observed residues (ATOM records): (download)

>d1h9db_ b.54.1.1 (B:) Core binding factor beta, CBF {Human (Homo sapiens) [TaxId: 9606]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqarfqnacrdgrseiafvatg
tnlslqffptpsreyvdlereagkvylkapmilngvcviwkgwidlqrldgmgclefdee
raqqe

SCOPe Domain Coordinates for d1h9db_:

Click to download the PDB-style file with coordinates for d1h9db_.
(The format of our PDB-style files is described here.)

Timeline for d1h9db_: