Lineage for d1h9ba1 (1h9b A:1-181,A:413-426)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1152379Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1152526Protein Glucose 6-phosphate dehydrogenase, N-terminal domain [51827] (2 species)
  7. 1152536Species Leuconostoc mesenteroides [TaxId:1245] [51828] (9 PDB entries)
  8. 1152542Domain d1h9ba1: 1h9b A:1-181,A:413-426 [60818]
    Other proteins in same PDB: d1h9ba2
    complexed with so4; mutant

Details for d1h9ba1

PDB Entry: 1h9b (more details), 2.4 Å

PDB Description: active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
PDB Compounds: (A:) glucose 6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1h9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ba1 c.2.1.3 (A:1-181,A:413-426) Glucose 6-phosphate dehydrogenase, N-terminal domain {Leuconostoc mesenteroides [TaxId: 1245]}
vseiktlvtffggtgdlakrklypsvfnlykkgylqkhfaivgtarqalnddefkqlvrd
sikdftddqaqaeafiehfsyrahdvtdaasyavlkeaieeaadkfdidgnrifymsvap
rffgtiakylkseglladtgynrlmiekpfgtsydtaaelqndlenafddnqlfridhyl
gXepyermihdtmngd

SCOPe Domain Coordinates for d1h9ba1:

Click to download the PDB-style file with coordinates for d1h9ba1.
(The format of our PDB-style files is described here.)

Timeline for d1h9ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ba2